PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G56270.1
Common NameATWRKY2, K24C1.9, MXK23.1, WRKY2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 687aa    MW: 74561.1 Da    PI: 5.9843
Description WRKY DNA-binding protein 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G56270.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.11.4e-31273329259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  +DgynWrKYGqK vkgse+prsYY+Ct ++C+vkkkvers+ +++++ei+Y+g Hnh 
  AT5G56270.1 273 EDGYNWRKYGQKLVKGSEYPRSYYKCTNPNCQVKKKVERSR-EGHITEIIYKGAHNHL 329
                  8****************************************.***************5 PP

2WRKY103.89.2e-33486544159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d k v++tYeg+Hnh+
  AT5G56270.1 486 LDDGYRWRKYGQKVVKGNPNPRSYYKCTAPGCTVRKHVERASHDLKSVITTYEGKHNHD 544
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.3E-28267331IPR003657WRKY domain
PROSITE profilePS5081123.169267331IPR003657WRKY domain
SuperFamilySSF1182901.31E-24270331IPR003657WRKY domain
SMARTSM007742.1E-34272330IPR003657WRKY domain
PfamPF031065.1E-24273328IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.9E-37471546IPR003657WRKY domain
SuperFamilySSF1182901.57E-28478546IPR003657WRKY domain
PROSITE profilePS5081138.136481546IPR003657WRKY domain
SMARTSM007741.8E-37486545IPR003657WRKY domain
PfamPF031068.9E-25487544IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MAGFDENVAV MGEWVPRSPS PGTLFSSAIG EEKSSKRVLE RELSLNHGQV IGLEEDTSSN  60
HNKDSSQSNV FRGGLSERIA ARAGFNAPRL NTENIRTNTD FSIDSNLRSP CLTISSPGLS  120
PATLLESPVF LSNPLAQPSP TTGKFPFLPG VNGNALSSEK AKDEFFDDIG ASFSFHPVSR  180
SSSSFFQGTT EMMSVDYGNY NNRSSSHQSA EEVKPGSENI ESSNLYGIET DNQNGQNKTS  240
DVTTNTSLET VDHQEEEEEQ RRGDSMAGGA PAEDGYNWRK YGQKLVKGSE YPRSYYKCTN  300
PNCQVKKKVE RSREGHITEI IYKGAHNHLK PPPNRRSGMQ VDGTEQVEQQ QQQRDSAATW  360
VSCNNTQQQG GSNENNVEEG STRFEYGNQS GSIQAQTGGQ YESGDPVVVV DASSTFSNDE  420
DEDDRGTHGS VSLGYDGGGG GGGGEGDESE SKRRKLEAFA AEMSGSTRAI REPRVVVQTT  480
SDVDILDDGY RWRKYGQKVV KGNPNPRSYY KCTAPGCTVR KHVERASHDL KSVITTYEGK  540
HNHDVPAARN SSHGGGGDSG NGNSGGSAAV SHHYHNGHHS EPPRGRFDRQ VTTNNQSPFS  600
RPFSFQPHLG PPSGFSFGLG QTGLVNLSMP GLAYGQGKMP GLPHPYMTQP VGMSEAMMQR  660
GMEPKVEPVS DSGQSVYNQI MSRLPQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37273547878Probable WRKY transcription factor 4
2lex_A2e-37273547878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.215270.0floral meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306967200.0
Genevisible248008_at0.0
Expression AtlasAT5G56270-
AtGenExpressAT5G56270-
ATTED-IIAT5G56270-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Low expression in senescent leaves (PubMed:11722756). Expressed in both the unfertilized egg cell and the pollen tube (PubMed:21316593). {ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:21316593}.
Functional Description ? help Back to Top
Source Description
TAIRWRKY transcription factor 2
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Function -- GeneRIF ? help Back to Top
  1. wrky2 mutants are hypersensitive to ABA responses during postgermination growth.
    [PMID: 19622176]
  2. Epistasis interaction analysis confirmed that MPK6 belongs to the same genetic pathway of WRKY34 and WRKY2
    [PMID: 24830428]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G56270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT2G36270 (A), AT3G24650 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G36270(A), AT2G40170(R), AT3G24650(A), AT3G51810(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Strong defects in embryo development. {ECO:0000269|PubMed:21316593}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G56270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4183080.0AF418308.1 Arabidopsis thaliana WRKY transcription factor 2 (WRKY2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200438.10.0putative WRKY transcription factor 2
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLD7ML960.0D7ML96_ARALL; Putative uncharacterized protein
STRINGAT5G56270.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79542740
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Robatzek S,Somssich IE
    A new member of the Arabidopsis WRKY transcription factor family, AtWRKY6, is associated with both senescence- and defence-related processes.
    Plant J., 2001. 28(2): p. 123-33
    [PMID:11722756]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  6. Andersson-Gunner
    Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis.
    Plant J., 2006. 45(2): p. 144-65
    [PMID:16367961]
  7. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  8. Jiang W,Yu D
    Arabidopsis WRKY2 transcription factor mediates seed germination and postgermination arrest of development by abscisic acid.
    BMC Plant Biol., 2009. 9: p. 96
    [PMID:19622176]
  9. Ueda M,Zhang Z,Laux T
    Transcriptional activation of Arabidopsis axis patterning genes WOX8/9 links zygote polarity to embryo development.
    Dev. Cell, 2011. 20(2): p. 264-70
    [PMID:21316593]
  10. Guan Y, et al.
    Phosphorylation of a WRKY transcription factor by MAPKs is required for pollen development and function in Arabidopsis.
    PLoS Genet., 2014. 10(5): p. e1004384
    [PMID:24830428]
  11. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]